![]() Plants, fungi, plastids (eukaryotes other than animals)īacteria (including both Eubacteria and Archaea) Invertebrates (animals other than vertebrates) Mammals (other than primates and rodents) FIELD COMMENTSĭDBJ classifies entries into 21 divisions as below Please take that point into consideration when you refer search results. Vary according to the submitter’s research aim etc. YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTGġ cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctctĦ1 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcggġ21 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgcġ81 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgtĢ41 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcggģ01 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagacģ61 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgcįlat file displays the information provided by submitters with DDBJĮven when the sequences are similar, the contents on the flat files may translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT product="glyceraldehyde-3-phosphate dehydrogenase" clone_lib="lambda gt11 human liver cDNA (GeneTech. TITLE Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver National Institute of Genetics, DNA Data Bank of Japan Yata 1111,ĪUTHORS Mishima,H., Shizuoka,T. JOURNAL Submitted (3) to the DDBJ/EMBL/GenBank databases. Mammalia Eutheria Euarchontoglires Primates Haplorrhini The virtual sample of DDBJ flat file LOCUS AB000000 450 bp mRNA linear HUM 0 DEFINITION Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphateĮukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi To describe the biological nature such as gene function and other The DDBJ/ENA/GenBank Feature Table Definition Organisms, and “feature” information, etc. Sequence and the information of submitters, references, source The entry submitted to DDBJ is processed and publicized according to theĭDBJ format for distribution (flat file). The database is a collection of “entry” which is the unit of the data. Office (EPO), United States Patent and Trademark The database also includes the data from Japan Patent With the rule agreed with the three databanks. :: MORE INFORMATION Posted on 8 8 Categories DNA / Genome Analysis, Plasmid / Chemical Drawing Tags Analysis, DNA Cloning, Gene Construction Kit, Plasmid Mapping, Vector Manipulation Leave a comment on Gene Construction Kit 4.DDBJ flat file format DDBJ flat file formatĭDBJ/EMBL-Bank/GenBank, the International Nucleotide Sequence DatabaseĬollaboration ( INSDC) collects the nucleotide sequencesĮxperimentally determined, and constructs the database in accordance The Gene Construction Kit software is available for both Windows and Macintosh users, and files can be shared across platforms allowing for easy collaboration. This DNA analysis software allows multiple files to be opened and displayed simultaneously, allowing DNA sequences to easily be copied and pasted between plasmids and vectors to represent real-world DNA cloning protocols. GCK eliminates tedious examination of DNA sequence data by automatically identifying open reading frames (ORF’s), keeping track of sticky ends during cutting and pasting of restriction enzyme digestion fragments, assisting with PCR primer design, and enabling comprehensive annotation of DNA sequence features. GCK allows easy manipulation of DNA sequences, either graphically or as sequence text – quickly saving users both time and money. The Gene Construction Kit®(GCK) program has been the preferred plasmid mapping software of leading researchers for more than 20 years. ![]() :: MORE INFORMATION Posted on 0 0 Categories DNA / Genome Analysis Tags DNA Cloning, Sequence Analysis, SERIAL CLONER, Visualisation Leave a comment on SERIAL CLONER 2.6.1 – DNA Cloning, Sequence Analysis & Visualisation Gene Construction Kit 4.5 – Plasmid Mapping, DNA Cloning Analysis, Vector Manipulation ![]() Serial Cloner handles Annotations and Features both in the sequence and in the Graphic Map. Powerful graphical display tools and simple interfaces help the analysis and construction steps in a very intuitive way. Import from MacVector is also possible now. Serial Cloner also import files saved in the Vector NTI, ApE, pDRAW32 and GenBank formats. Serial Cloner reads and write DNA Strider-compatible files and import and export files in the universal FASTA format. Serial Cloner has been developed to provide a light molecular biology software to both Macintosh and Windows users.
0 Comments
![]() This parallel conversion effectively divides the input clock frequency by 8, 16, or 32. The alternative method is parallel CRC calculations. The classic serial implementation is widely used, but it is too slow for PCI Express LCRC and Gigabit Ethernet where bit rates can top 100 Mb/sec. The traditional method for implementing a CRC generator uses a shift register with XOR gates and feedback taps. The receiver upon reception of the data frame repeats the calculation and compares its calculated CRC value the CRC value attached to the data frame. EDC17/MED17/MEV17 EEPROM Checksum Calculator IMMO off Software IMMO Universal Decoding 4.5 Works With Upa USB Programmmer Brand NameITCARDIAG OriginMainland. The binary number is divided (at the CRC generation end) by a fixed binary number (the CRC generator polynomial) and the resulting remainder of this division (CRC value) is appended to the end of the data frame. Checksum Calculator is a free file checksum calculation utility, it can support the most commonly used file checksum algorithm, such as md5, crc32. crc32 checksum-calculation checksum-validator. It aims to work in the same way as the md5sum utility. The CRC method for error detection and correction treats the data frame as a huge binary number. A simple utility that calculates the CRC-32 checksum for each of the given files or for data from standard input. Most Linux distributions already came with the command line tools for verifying checksums in various algorithms as listed below.įor example, you can verify the SHA-1 checksum of the Debian 10.1 ISO with this command.PCI express CRC verilog code 16 bit data 32 bit CRCĭesigners commonly use Cyclic Redundacy Codes (CRC) as an alternative to parity and checksum calcutions for checking and correcting errors in data transmissions. then select the function and click the 'Calculate' button. ![]() ![]() Verifying the checksum of a file on Linux is very simple and straightforward. Checksums calculator a tool to calculate md5,sha1,sha256,sha384,sha512,checksums. It offers a choice of 13 of the most popular hash and checksum algorithms for calculations. How to verify the checksum of a file on Linux A fast and easy-to-use calculator that allows to compute message digests, checksums and HMACs for files, as well as for text and hex strings. A checksum is also known as a hash sum, hash value, hash code, or simply hash. In other words, the calculated checksum must be exactly the same as the provided one.Īdditionally, checksums are case insensitive, it doesn't matter if they are in lowercase or uppercase. You can use your preferred algorithm to verify the integrity of your copy of the file if it's genuine. Checksums are mostly used for comparing between the source of a file and a copy of it to ensure that the copy is identical to the source.įor example, when downloading an ISO file especially an ISO image from the official site, generally, several checksums in different algorithms are also provided on the download page e.g. When you're done, you can copy the calculated checksum to your clipboard using the copy button.Ī checksum is a calculated value using a cryptographic hash function to verify the integrity of data, such as a binary file. The result will be displayed accordingly. Optionally, you can also compare an expected checksum against the calculated one to ensure if the file integrity or text hash is correct. Text Checksum Calculator - Calculates the checksum of a string using the selected algorithm also known as hash generator. This mode completely works offline on your browser, so you're not uploading anything to the internet. The result will be displayed accordingly when the reading process is done. 3) For example, 01 12 45 30 22 11, add the 8-bit values to obtain the checksum bb 4) For example, 01 12 45 30 22 11 cc, after adding the 8-bit values, the result is greater than 255, and after the twos are complemented, the checksum is 79 5) The checksum checksum algorithm is inconsistent, and the result may be different. The checksum (aka hash sum) calculation is a one-way process of mapping an extensive data set of variable length. In this post, I am sharing an easy way of generating a checksum of arbitrary text or content of a file in Node.js. The result will be displayed accordingly. How to calculate checksum of arbitrary text or content of a file in Node.js. This tool is split into two modes: File Checksum Calculator and Text Checksum Calculator.įile Checksum Calculator - Calculates the checksum of a file using the selected algorithm. Text Checksum Calculator - Calculates the checksum of a string using the selected algorithm also known as hash generator. Checksum Calculator is a free online developer tool to quickly calculate the checksum of a file or text and compare against it on your browser without uploading anything. ![]()
You will be a Roman governor in this game, and your mission will be to protect your city from enemies. instead you can enjoy all of its modified version of this game with you really enjoying and inspired from.Total Conquest is an action-adventure game in which you must devise various ways to defeat your opponents. ![]() Total conquest Mod APK is the incredible game which you can now enjoy unlimited by using all of its Incredible features which you will never get bored by. The simple procedure is to download this total conquest Mod APK game by searching on the Google Play Store App where you find this game, click on that and you will see the installation button and click on that and now you are ready to install this game. The Procedure of Downloading Total Conquest Mod Apk You must choose the incredible total conquest mod APK game because this provides you unlimited features, having infinite and unpaid so that the user will really enjoy it and never find any kind of hurdle by the use of this modified version of this incredible game. You can now easily unlock the premium features in this game because this is the modified version in which you can now easily use all of its features. There will be all blocked unwanted advertisement videos and notifications so that the user can peacefully play this amazing game. ![]() There will be unlimited money for you to enjoy by the use of this incredible modified version so that you can enjoy unlimited with their own choice. You can now enjoy unlimited resources by the use of this incredible total conquest mod APK game very easily. Features of Total Conquest Mod Apk Unlimited resources You can now easily download total conquest mod APK latest version of this incredible game so that you can enjoy all of its latest features. ![]() Download Total Conquest Mod Apk Latest Version 2023 Total conquest Mod APK is the special version of this incredible game as it is the modified version in which you can now enjoy all of its modified and unlimited unpaid features which will really like it as it does not create any kind of trouble for the user to face. Why is the Total Conquest Mod Apk so Special? You can create different unlimited jobs for the people in your city as well as staff, which is a really bossy character for you to play in this amazing game. You can now capture different indications having amazing sides by the use of this incredible game which will really like it. You can now build your own City by the use of this game which is really interesting for you as well as new features for you to use. This incredible total conquest APK game provides an interesting as well as incredible interface for every user to use as you can easily enjoy all of its features without finding any kind of trouble in it. ![]() This incredible game provides you with 3D graphics which are interesting as well as very incredible for you to use as well as it provides impressive sound effects which you really like and never get bored by them. This incredible game provides a simple control mechanism of this game so that you will really like it by using all of its Incredible features without finding any kind of disappointing features. Total conquest APK standard version of this incredible game which you can now all of its standard features but there will be some shortcomings that are present in this version only as it has some paid features as well as advertisement videos or notifications that may be encountered with.įeatures of Total Conquest Apk Simple control mechanism You will really enjoy this incredible game because it provides infinite features and never gets bored by its amazing and simple use and interface which you will now use by using this modified version of this incredible game. ![]() PDFelement is a simple and straightforward PDF converter that provides complete control for PDF files. They weren’t bad in any way and would suffice for the job but with some little issues here and there. However, we tested some other applications which didn’t make the top list. The above recommendations were something that we felt was the best in the slot for the performance and stable consistency they delivered. With a massive number of features, the app experiences longer boot or start-up times.Expensive with the packages starting at 50 dollars and climbing up to 75 dollars.Can work with any picture or screenshots.Excellent scanning capabilities with machine learning built-in.The document scanning abilities are incredible, and the newly introduced machine learning capabilities make Prizmo one of the best on the market. It works with your iPhone, iPad, or Android device to capture and scan physical documents and even support screenshots. Prizmo comes equipped with Optical Character Recognition support in 28 different languages with powerful editing capabilities, built-in text-to-speech recognition, iCloud support, and translation to 59 various languages. ![]() If you would like to have something documented, take a picture, and Prizmo completes the process by taking the right perspective, cropping the image, and enhancing the photo. Prizmo is a scanner app that can be used for anything. Price: Free (However, houses in-app purchases)
The treatment rooms were even nicer, and the dental chair itself looked and felt like something out of a spa! Rami Etessami! The office was quite something! It was expertly decorated with comfortable chairs, a coffee station and pictures and documents framed all over the walls. (They cost a bit more, but you DON'T want to mess around with an abscess-Its beyond a regular root canal, and beyond the scope of a general dentist!) Most Comfortable Dental Appointment Ever – After finding out during at a routine cleaning/exam that my 'loose filling' was actually an abscess, I was forced to seek out an endodontist in the area for an expert root canal. Etessami has passed my strict definition of quality care. I know how hard it is to find a doctor or dentist when you do not have family or friends in the medical industry to guide your decisions. Although my boss felt very little discomfort, for a difficult and complex root canal treatment, the Doctor immediately called our local pharmacy so we could get another prescription filled before traveling. Etessami’s office called to follow up on his after care. Etessami called Joel to make sure he was doing well, the next day. It was imperative to get a surgeon who can understand his guarded outlook.ĭr. It is because he had a previous root canal procedure and was very hesitant. My boss really appreciated his attention to detail and made the experience pleasant, for a root canal procedure. Etessami, was very proactive, and professional. I look for quality of service, comfort, and ability to communicate effectively with all of my vendors. Rami Etessami’s contact information, as this recommendation came from a colleague in Beverly Hills, I felt confident in my choice. There was a suggestion of a general dentist in Beverly Hills, however, we needed a specialist to ensure the best quality of service. I had asked the members of my group (ACPA), for suggestions. When my boss, the CEO/Founder of a mobile application company, needed to get a root canal, he only wanted the very best. I am a long time member of the Association of Celebrity Personal Assistants (“ACPA”) in LA. When you want to be taken care of like family (that you actually like), call Dr. If only I could play piano anywhere near to his level of perfection.īut then.there was only one Mozart, right? And ….there is only one Rami Etessami. It'll be the first dental office you "won't" want to LEAVE! You'll "know".how lucky you are in that moment in time. while at the same time the overflow of his compassionate huge heart is the extra freebie you feel when you're there. Rami gives incredible grace and artistic dental perfection.on the teeth.……. You'll be glad you made the journey.Ĭhopin, were gifted rare souls that made such sublime beauty. If you have to fly, take a bus, taxi, train, or boat, bike, then DO IT. If you're in pain and can suffer "while" you get there, then do so, and don't go ANYWHERE ELSE. ![]() He allows nothing but absolute perfection and you are put at pure Peace by his graceful benevolence while having work done. He Epitomizes the word "perfection" and you simply CANNOT FIND ANY BETTER PLACE TO have ANYTHING done in your mouth, ON THE PLANET. His soul radiates with compassion-you are enveloped in his compassion at the same time as he delivers such precision and absolute perfection in his work in your mouth. ![]() ![]() He "feels" and knows your pain, BELIEVE ME. He is in "tune" with the ….well.the TEETH.shall we say. There are "nice" dentists.then there is that rare special "soul" that you "KNOW" when you experience it. He's got the special "touch" and the special gifted "soul" that YOU WILL NOT FIND ANYWHERE. To compare Rami to Mozart, Bach, Beethoven is a perfect example. ![]() Rami specifically.….is not only a "genius" in every definition, but he is God gifted. Hence, I've been chopped up, and dragged through someĭr. ![]() Therefore, on the way, cleverly avoid attacking weapons, and collect as many coins as possible. Just to ensure safety, just have to collect coins to buy equipment. Every time a trap appears, you need to quickly click on the screen to change its position. This means that controlling the motor core will be more difficult. ![]() Over time, the character’s speed increases. Move quickly and skillfully to ensure safety. ![]() Immediately, the weapon is fired to destroy you. Your presence has enabled the protection of this place. The goal of the jet engine is to go deep into the laboratory. After opening this door, you will begin your journey of discovery. The opening of Jetpack Joyride is the scene breaking the lab door. Once you get used to the rhythm of the game, the experience will become more interesting than ever. In general, the gameplay of the game is quite fast. In addition, the game also has a lot of styles for the character to change. Therefore, create your own achievements with your own abilities. The farther you go, the more points you get. How far the character can go depends entirely on your ability. ![]() Avoid colliding with dangerous weapons to reach the final destination. Will you overcome all to enter the “forbidden” area?Control your vehicle skillfully. Your level can be destructive weapons such as missiles, zappers, … prevent. Next to the jet engines is the defense of the weapons to protect the unauthorized access. The appearance of the player made the scientists present here feel surprised. This entertaining game is set in a mysterious laboratory. Jetpack Joyride is published by Halfbrick Studios. Download Jetpack Joyride Mod – Adventure Game with Barry Steakfries Let’s join Jetpack Joyride MOD APK to explore the mysteries in the laboratory. Players also have to perform parallel tasks against unauthorized intrusion. The products you are aiming for are the most powerful and perfect jet engines. Throughout the game is an endless journey in the laboratory. Publisher Halfbrick Studios has created a creative and challenging story for players. It never becomes dull due to the numerous events they organize.The Jetpack Joyride game brings new experiences to gamers thanks to its unique storyline. You get all the latest gadgets and skins after a few plays, and it’s a blast to play. It is one of the top games on the market. Barry smiles as it lands on the ground to the trails of sparkling sparkles that appear after the spin tokens. There are a lot of specifics that demonstrate how to care the developers take about the game. It’s lighthearted, entertaining, and just enough challenge to be an enjoyable challenge. I prescribe everybody to attempt this game and see with yourselves own eyes! It’s EVEN better than the one I had before. Taking a break perfect.īuying the modest twofold coins add-on makes it substantially more helpful and speedier to purchase skins, jetpacks, and redesigns an extraordinary venture! Also, with every one of the updates the game emerges with from creepy Halloween to happy Christmas subjects, its perpetual tomfoolery and amusement. Ive been a drawn out player for this game since it emerged. So when I found out there was a game available, it was only natural that I wanted to play it!Best game I’ve at any point played on telephone. I played for hours during long road trips and enjoyed playing with my family and friends to beat my scores. Jetpack Joyride MOD APK (MOD, Unlimited Money) – was my favorite game in my childhood. ![]() Requests should be directed to the appropriate thread above. Repeated infractions may result in a ban. If you ask a question that is answered in the EVERYTHING YOU NEED TO KNOW thread, it will get be deleted. Failure to get approval will get the links removed and you may lose posting privileges. These would include Password ZIP files, Baidu links and linking to a secondary site that uses any of the previously mentioned features. Links that require a password, have click thru links or that require a special account to access require mod approval. ![]() This includes sites which require a login and or password. This will get you banned.ĭirect links to downloads located on private servers (anything but a public file host) require mod approval. No monetization links such as adfly or other revenue generating links. No asking people to pay for you to download and dump a game. These actions will be met with an immediate ban The gerenal rules of reddit apply here but are not limited to no doxxing, no threatening violence, etc. Piracy is bad, we advocate only backing up games which are already owned by you, the user. If creating a game download thread, please include the title gameID and Dump Tool Version. So, by all means, come chat with us!Īll references to piracy in this subreddit should be translated to "game backups". ![]() NoNpDrm Request Thread+Previous NoNPDrm request threadsįor updates on NPS, feel free to check their twitter or rss feed Our offical IRC channel can be found here or via /#VitaPiracy on any irc client. ![]() Main articles: Badminton at the 2020 Summer Olympics and Badminton at the 2020 Summer Olympics – Qualification ![]() Field events AthleteĬombined events – Women's heptathlon Athlete Bye = Athlete not required to compete in roundĪ Athletes who participated in the heat only.N/A = Round not applicable for the event.q = Qualified for the next round as a fastest loser or, in field events, by position without achieving the qualifying target.Note–Ranks given for track events are within the athlete's heat only.Another Dutch archer scored a shoot-off victory in the quarterfinal round of the women's individual recurve to book an outright Olympic berth available at the 2019 European Games in Minsk, Belarus. Three Dutch archers qualified for the men's events by reaching the quarterfinal stage of the men's team recurve at the 2019 World Archery Championships in 's-Hertogenbosch. Hassan’s grueling schedule means she will have to run six races in eight days in the Tokyo heat and humidity, including those two races on Monday and the 1,500 and 10,000 finals on back-to-back days on Friday and Saturday.Main articles: Archery at the 2020 Summer Olympics and Archery at the 2020 Summer Olympics – Qualification No athlete has won 1,500-, 5,000- and 10,000-meter golds at the same Olympics. She has said she will also run in the 10,000 meters at the Olympics. Hassan won a 1,500-10,000-meter double at the world championships in Doha, Qatar in 2019. Hassan, who was born in Ethiopia but moved to the Netherlands as a refugee, is expected to battle with two-time world champion Hellen Obiri of Kenya for the 5,000 gold, while there are three Ethiopians also challenging for a medal. Hassan didn’t stop to speak to reporters after the 1,500 race as she rushed away to recover and prepare for the 5,000 final. Hassan had already qualified to run in the 5,000-meter final later Monday at the Olympic Stadium, although the energy she expended on that last-lap scramble in the 1,500 heats might catch up with her when she returns in the evening session to try for her first gold of the Games. ![]() Her recovery kept alive her bid for the treble in Tokyo. ![]() She was third-from-last at the start of the final lap and just before she fell. Hassan finished in 4 minutes, 5.17 seconds to qualify for the semifinals, although she nearly paid dearly for the decision to run at the back of the field in the early stages of the race and wait for the bell to make her move. Pierre after powering down the home straight. Staring at a shock elimination, the Dutch runner sped past a couple of runners down the back straight, had reached the leading pack by the last bend, and won from Australia’s Jessica Hull and American Elinor Purrier St. Hassan also went crashing down but rolled, quickly got back to her feet and set about chasing down the pack in an astonishing comeback. Hassan tried, but failed, to hurdle over Kenya’s Edinah Jebitok, who tumbled just in front of her as runners jostled for position at the start of the final lap. TOKYO (AP) - Sifan Hassan’s bid for a distance treble at the Olympics was nearly derailed Monday when the world champion tripped over another runner and fell at the final bell of her 1,500-meter heat.Īmazingly, she ended up winning the race. ![]() Bucherer,3,Carl Suchy,1,Carrera,13,Cartier,46,ceramic,16,Certina,8,Chanel,4,Chaumet,3,chiming hour,12,Chopard,37,Christiaan van der Klaauw,1,Christie's,9,Christophe Claret,5,Christopher Ward,11,chronograph,645,chronometer,36,Chronoswiss,5,Citizen,3,co-axial,1,column-wheel,7,complete calendar,23,complications,85,concept watch,5,Concord,1,constant-force,39,Corum,18,Credor,1,CSEM,1,Cuervo y Sobrinos,1,Cyrus,28,Czapek,7,Dan Niederer,1,Davosa,1,Daytona,6,De Bethune,26,de Grisogono,3,dead seconds,20,detent escapement,2,DeWitt,9,digital display,1,dive watches,30,diving,8,diving watches,349,double regulator,3,Doxa,28,drei,1,dress watches,473,dual time,99,Ebel,1,Eberhard,35,Edouard Koehn,2,Edox,5,El Primero,38,Emile Chouriet,1,Emmanuel Bouchet,1,Emmanuel Breguet,1,enamel dial,11,enamelling,15,Equation of time,9,ETA,1,Eterna,18,exhibitions,1,F.P.Journe,37,Faberge,2,factory tours,3,Favre-Leuba,1,feature article,69,features,106,Felipe Pikullik,1,Ferdinand Berthoud,7,flyback,52,Fondation de la Haute Horlogerie,1,Fortis,8,Franc Vila Founder,1,Franck Muller,7,Frederic Jouvenot,1,Frederique Constant,15,Furlan Marri,1,FVF,1,Gallet,1,Geneva Watchmaking Grand Prix,8,Georg Jensen,1,George Daniels,4,Gerald Charles,2,Gerald Genta,12,Girard-Perregaux,47,Glashuette,19,Glashuette Original,76,Glashütte,33,Glashütte Original,109,Glycine,4,GMT,112,GoS,1,GoS Watches,1,GPHG,17,GPHG 2020,3,GPHG 2021,3,GPHG 2022,3,GPHG2019,1,Graham,6,Grand Feu,5,Grand Prix d’Horlogerie de Geneve,15,Grand Seiko,29,Grande Complication,27,Grande Sonnerie,8,Greubel Forsey,36,greubelforsey,1,Gronefeld,10,Grönefeld,8,Grossmann,3,guilloché,6,H. Lange & Sohne,127,Accutron,1,AkriviA,10,Alain Silberstein,2,alarm,13,Alpina,13,Andersen Geneve,2,Andersmann,2,Andreas Strehler,5,Angelus,5,annual calendar,41,Anonimo,15,Anthony de Haas,1,Antiquorum,4,Antoine Martin,2,Antoine Preziuso,1,Apple,2,Apple Watch,2,Aquadive,2,Aquastar,1,Armin Strom,69,Arnold and Son,24,Artime,1,Astarwatch,1,Atelier de Chronometrie,1,Ateliers deMonaco,2,Atmos,1,Auctions,78,Audemars Piguet,80,Autodromo,1,automaton,2,BA111OD,1,Ball Watch,1,Bamford,2,Baselword 2022,1,Baselworld,8,BaselWorld 2013,50,BaselWorld 2014,53,Baselworld 2015,69,Baselworld 2016,27,Baselworld 2017,64,Baselworld 2018,75,Baselworld 2019,41,Baselworld 2020,2,Baume,4,Baume et Mercier,55,Bell & Ross,36,Bernard Lederer Universe,1,Bernhard Lederer,2,Bernhard Zwinz,1,bespoke,1,Blancpain,83,BLU,1,blue dial,3,Bonhams,2,Bovet,11,Brands histories,1,Breguet,111,Breitling,64,Bremont,1,Bremont Watch Company,4,Breva,2,bronze,26,Bücherei,1,Bulgari,101,Bulova,1,Burberry,1,C3H5N3O9,1,carbon,2,carillon,3,Carl F. SIHH 2017: Vacheron Constantin - Les Cabinotiers C.Ī.Glashütte Original - Sixties Iconic Square Collection.SIHH 2017: Audemars Piguet - Royal Oak Extra-Thin. ![]() SIHH 2017: Montblanc - TimeWalker Chronograph Rall.Longines - Flagship Heritage 60th Anniversary 1957.SIHH 2017: Cartier - Drive de Cartier, 2017 new mo.Richard Mille - Jean Todt 50th Anniversary Collection.Zenith - El Primero 36’000 VpH Black and White.SIHH 2017: Jaeger-LeCoultre - Reverso Tribute, new.SIHH 2017: Greubel Forsey - Tourbillon 24 Secondes.Bell & Ross - BR03-92 Horograph and BR03-92 Horolum.SIHH 2017: Laurent Ferrier - Galet Micro Rotor "Mo.SIHH 2017: Panerai - Luminor Submersible 1950 BMG.Positive outlook for 2017 from major luxury groups.SIHH 2017: Roger Dubuis - Excalibur Spider Pirelli.Bucherer - Manero Flyback with Champagne Dial Omega - Speedmaster Racing Master Chronometer. ![]()
|